SCOPe 2.05: Domain d1k66b_: 1k66 B:

Lineage for d1k66b_ (1k66 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein Response regulator for cyanobacterial phytochrome [75152] (3 species)

7. Species Calothrix sp. pcc 7601, RcpB [TaxId:1188] [102227] (1 PDB entry)

8. Domain d1k66b_: 1k66 B: [90942]
   complexed with bme

Details for d1k66b_

PDB Entry: 1k66, 1.75 Å

PDB Description: Crystal Structure of the Cyanobacterial Phytochrome Response Regulator, RcpB

PDB Compounds: (B:) Phytochrome Response Regulator RcpB

SCOPe Domain Sequences for d1k66b_:

Sequence; same for both SEQRES and ATOM records:

>d1k66b_ c.23.1.1 (B:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]}
avgnatqpllvvedsdedfstfqrllqregvvnpiyrcitgdqaldflyqtgsycnpdia
prpavilldlnlpgtdgrevlqeikqdevlkkipvvimttssnpkdieicysysissyiv
kpleidrltetvqtfikywldivvlpemg

Timeline for d1k66b_:

• d1k66b_ first appeared in SCOP 1.67
  
• d1k66b_ appears in SCOPe 2.04
  
• d1k66b_ is called d1k66b1 in SCOPe 2.06
  
• d1k66b_ appears in the current release, SCOPe 2.08, called d1k66b1