Lineage for d1k66b_ (1k66 B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 390873Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 390874Superfamily c.23.1: CheY-like [52172] (5 families) (S)
  5. 390875Family c.23.1.1: CheY-related [52173] (16 protein domains)
  6. 390986Protein Response regulator for cyanobacterial phytochrome [75152] (3 species)
  7. 390990Species Calothrix sp. pcc 7601, RcpB [TaxId:1188] [102227] (1 PDB entry)
  8. 390992Domain d1k66b_: 1k66 B: [90942]
    complexed with bme

Details for d1k66b_

PDB Entry: 1k66 (more details), 1.75 Å

PDB Description: Crystal Structure of the Cyanobacterial Phytochrome Response Regulator, RcpB

SCOP Domain Sequences for d1k66b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k66b_ c.23.1.1 (B:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB}
avgnatqpllvvedsdedfstfqrllqregvvnpiyrcitgdqaldflyqtgsycnpdia
prpavilldlnlpgtdgrevlqeikqdevlkkipvvimttssnpkdieicysysissyiv
kpleidrltetvqtfikywldivvlpemg

SCOP Domain Coordinates for d1k66b_:

Click to download the PDB-style file with coordinates for d1k66b_.
(The format of our PDB-style files is described here.)

Timeline for d1k66b_: