SCOP 1.67: Domain d1k2x.1: 1k2x A:,B:

Lineage for d1k2x.1 (1k2x A:,B:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.5: (Glycosyl)asparaginase [56261] (1 protein)

6. Protein Glycosylasparaginase (aspartylglucosaminidase, AGA) [56262] (3 species)
   the precursor chain is cleaved onto 2 fragments by autoproteolysis

7. Species Escherichia coli [TaxId:562] [103315] (2 PDB entries)
   putative L-asparaginase YbiK

8. Domain d1k2x.1: 1k2x A:,B: [90929]

Details for d1k2x.1

PDB Entry: 1k2x, 1.65 Å

PDB Description: Crystal structure of putative asparaginase encoded by Escherichia coli ybiK gene

SCOP Domain Sequences for d1k2x.1:

Sequence; same for both SEQRES and ATOM records:

>g1k2x.1 d.153.1.5 (A:,B:) Glycosylasparaginase (aspartylglucosaminidase, AGA) {Escherichia coli}
gkaviaihggagaisraqmslqqelryiealsaivetgqkmleagesaldvvteavrlle
ecplfnagigavftrdetheldacvmdgntlkagavagvshlrnpvlaarlvmeqsphvm
migegaenfafargmervspeifstslryeqllaarXtvgavaldldgnlaaatstggmt
nklpgrvgdsplvgagcyannasvavsctgtgevfiralaaydiaalmdygglslaeace
rvvmeklpalggsggliaidhegnvalpfntegmyrawgyagdtpttgiyre

Timeline for d1k2x.1:

• d1k2x.1 is new in SCOP 1.67
  
• d1k2x.1 appears in SCOP 1.69
  
• d1k2x.1 appears in the current release, SCOPe 2.08