Lineage for d1k2x.1 (1k2x A:,B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 512789Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 512790Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 513243Family d.153.1.5: (Glycosyl)asparaginase [56261] (1 protein)
  6. 513244Protein Glycosylasparaginase (aspartylglucosaminidase, AGA) [56262] (3 species)
    the precursor chain is cleaved onto 2 fragments by autoproteolysis
  7. 513245Species Escherichia coli [TaxId:562] [103315] (3 PDB entries)
    isoaspartyl peptidase with L-asparaginase activity
    putative L-asparaginase YbiK
  8. 513246Domain d1k2x.1: 1k2x A:,B: [90929]

Details for d1k2x.1

PDB Entry: 1k2x (more details), 1.65 Å

PDB Description: Crystal structure of putative asparaginase encoded by Escherichia coli ybiK gene

SCOP Domain Sequences for d1k2x.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1k2x.1 d.153.1.5 (A:,B:) Glycosylasparaginase (aspartylglucosaminidase, AGA) {Escherichia coli}
gkaviaihggagaisraqmslqqelryiealsaivetgqkmleagesaldvvteavrlle
ecplfnagigavftrdetheldacvmdgntlkagavagvshlrnpvlaarlvmeqsphvm
migegaenfafargmervspeifstslryeqllaarXtvgavaldldgnlaaatstggmt
nklpgrvgdsplvgagcyannasvavsctgtgevfiralaaydiaalmdygglslaeace
rvvmeklpalggsggliaidhegnvalpfntegmyrawgyagdtpttgiyre

SCOP Domain Coordinates for d1k2x.1:

Click to download the PDB-style file with coordinates for d1k2x.1.
(The format of our PDB-style files is described here.)

Timeline for d1k2x.1: