Lineage for d1jueb_ (1jue B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1567263Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 1567264Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 1567309Protein Dihydroorotate dehydrogenase [51397] (8 species)
  7. 1567343Species Lactococcus lactis, isozyme A [TaxId:1358] [51398] (9 PDB entries)
  8. 1567349Domain d1jueb_: 1jue B: [90911]
    complexed with acy, fmn, gol, mg

Details for d1jueb_

PDB Entry: 1jue (more details), 1.8 Å

PDB Description: 1.8 A resolution structure of native lactococcus lactis dihydroorotate dehydrogenase A
PDB Compounds: (B:) dihydroorotate dehydrogenase a

SCOPe Domain Sequences for d1jueb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jueb_ c.1.4.1 (B:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]}
mlnttfanakfanpfmnasgvhcmtiedleelkasqagayitksstlekregnplpryvd
lelgsinsmglpnlgfdyyldyvlknqkenaqegpiffsiagmsaaeniamlkkiqesdf
sgitelnlscpnvpgkpqlaydfeatekllkevftfftkplgvklppyfdlvhfdimaei
lnqfpltyvnsvnsignglfidpeaesvvikpkdgfggiggayikptalanvrafytrlk
peiqiigtggietgqdafehllcgatmlqigtalhkegpaifdriikeleeimnqkgyqs
iadfhgklksl

SCOPe Domain Coordinates for d1jueb_:

Click to download the PDB-style file with coordinates for d1jueb_.
(The format of our PDB-style files is described here.)

Timeline for d1jueb_: