Lineage for d1j3pa_ (1j3p A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2423915Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2424206Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (2 proteins)
    automatically mapped to Pfam PF06560
  6. 2424207Protein Glucose-6-phosphate isomerase, GPI [89404] (2 species)
    Type II phosphoglucose isomerase
  7. 2424227Species Thermococcus litoralis [TaxId:2265] [101975] (3 PDB entries)
  8. 2424230Domain d1j3pa_: 1j3p A: [90819]
    complexed with fe

Details for d1j3pa_

PDB Entry: 1j3p (more details), 2.02 Å

PDB Description: crystal structure of thermococcus litoralis phosphoglucose isomerase
PDB Compounds: (A:) phosphoglucose isomerase

SCOPe Domain Sequences for d1j3pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j3pa_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Thermococcus litoralis [TaxId: 2265]}
mkykepfgvkldfetgiienakksvrrlsdmkgyfideeawkkmveegdpvvyevyaieq
eekegdlnfattvlypgkvgneffmtkghyhskidraevyfalkgkggmllqtpegearf
iemepgtivyvppywahrtintgdkpfiflalypadaghdygtiaekgfskivveengkv
vvkdnpk

SCOPe Domain Coordinates for d1j3pa_:

Click to download the PDB-style file with coordinates for d1j3pa_.
(The format of our PDB-style files is described here.)

Timeline for d1j3pa_: