SCOP 1.71: Domain d1j27a_: 1j27 A:

Lineage for d1j27a_ (1j27 A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.50: Hypothetical protein TT1725 [103007] (1 family)

5. Family d.58.50.1: Hypothetical protein TT1725 [103008] (1 protein)

6. Protein Hypothetical protein TT1725 [103009] (1 species)

7. Species Thermus thermophilus [TaxId:274] [103010] (1 PDB entry)
   structural genomics

8. Domain d1j27a_: 1j27 A: [90778]

Details for d1j27a_

PDB Entry: 1j27, 1.7 Å

PDB Description: Crystal structure of a hypothetical protein, TT1725, from Thermus thermophilus HB8 at 1.7A resolution

SCOP Domain Sequences for d1j27a_:

Sequence; same for both SEQRES and ATOM records:

>d1j27a_ d.58.50.1 (A:) Hypothetical protein TT1725 {Thermus thermophilus}
mkaylglytarletparslkekralikpalerlkarfpvsaarlygldawgyevvgftll
gndpawveetmraaarflaeaggfqvaleefrleafel

Timeline for d1j27a_:

• d1j27a_ first appeared in SCOP 1.67
  
• d1j27a_ appears in SCOP 1.69
  
• d1j27a_ appears in SCOP 1.73
  
• d1j27a_ appears in the current release, SCOPe 2.08