![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.50: Hypothetical protein TT1725 [103007] (1 family) ![]() automatically mapped to Pfam PF04456 |
![]() | Family d.58.50.1: Hypothetical protein TT1725 [103008] (1 protein) |
![]() | Protein Hypothetical protein TT1725 [103009] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [103010] (1 PDB entry) structural genomics |
![]() | Domain d1j27a_: 1j27 A: [90778] |
PDB Entry: 1j27 (more details), 1.7 Å
SCOPe Domain Sequences for d1j27a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j27a_ d.58.50.1 (A:) Hypothetical protein TT1725 {Thermus thermophilus [TaxId: 274]} mkaylglytarletparslkekralikpalerlkarfpvsaarlygldawgyevvgftll gndpawveetmraaarflaeaggfqvaleefrleafel
Timeline for d1j27a_: