Lineage for d1j27a_ (1j27 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955773Superfamily d.58.50: Hypothetical protein TT1725 [103007] (1 family) (S)
    automatically mapped to Pfam PF04456
  5. 2955774Family d.58.50.1: Hypothetical protein TT1725 [103008] (1 protein)
  6. 2955775Protein Hypothetical protein TT1725 [103009] (1 species)
  7. 2955776Species Thermus thermophilus [TaxId:274] [103010] (1 PDB entry)
    structural genomics
  8. 2955777Domain d1j27a_: 1j27 A: [90778]

Details for d1j27a_

PDB Entry: 1j27 (more details), 1.7 Å

PDB Description: Crystal structure of a hypothetical protein, TT1725, from Thermus thermophilus HB8 at 1.7A resolution
PDB Compounds: (A:) hypothetical protein TT1725

SCOPe Domain Sequences for d1j27a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j27a_ d.58.50.1 (A:) Hypothetical protein TT1725 {Thermus thermophilus [TaxId: 274]}
mkaylglytarletparslkekralikpalerlkarfpvsaarlygldawgyevvgftll
gndpawveetmraaarflaeaggfqvaleefrleafel

SCOPe Domain Coordinates for d1j27a_:

Click to download the PDB-style file with coordinates for d1j27a_.
(The format of our PDB-style files is described here.)

Timeline for d1j27a_: