Lineage for d1j1qa_ (1j1q A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2999974Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2999975Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2999976Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 3000012Protein Antiviral protein S [103333] (1 species)
    seed isoform
  7. 3000013Species Pokeweed (Phytolacca americana) [TaxId:3527] [103334] (4 PDB entries)
  8. 3000014Domain d1j1qa_: 1j1q A: [90768]
    complexed with nag

Details for d1j1qa_

PDB Entry: 1j1q (more details), 1.8 Å

PDB Description: structure of pokeweed antiviral protein from seeds (pap-s1)
PDB Compounds: (A:) antiviral protein s

SCOPe Domain Sequences for d1j1qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j1qa_ d.165.1.1 (A:) Antiviral protein S {Pokeweed (Phytolacca americana) [TaxId: 3527]}
intitfdagnatinkyatfmeslrneakdpslkcygipmlpntnstikyllvklqgaslk
titlmlrrnnlyvmgysdpydnkcryhifndikgteysdventlcpssnprvakpinyng
lyptlekkagvtsrnevqlgiqilssdigkisgqgsftekieakfllvaiqmvseaarfk
yienqvktnfnrdfspndkvldleenwgkistaihnskngalpkplelknadgtkwivlr
vdeikpdvgllnyvngtcqat

SCOPe Domain Coordinates for d1j1qa_:

Click to download the PDB-style file with coordinates for d1j1qa_.
(The format of our PDB-style files is described here.)

Timeline for d1j1qa_: