![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) contains mixed beta-sheet |
![]() | Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) ![]() |
![]() | Family d.165.1.1: Plant cytotoxins [56372] (18 proteins) |
![]() | Protein Antiviral protein S [103333] (1 species) seed isoform |
![]() | Species Pokeweed (Phytolacca americana) [TaxId:3527] [103334] (4 PDB entries) |
![]() | Domain d1j1qa_: 1j1q A: [90768] complexed with nag |
PDB Entry: 1j1q (more details), 1.8 Å
SCOPe Domain Sequences for d1j1qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j1qa_ d.165.1.1 (A:) Antiviral protein S {Pokeweed (Phytolacca americana) [TaxId: 3527]} intitfdagnatinkyatfmeslrneakdpslkcygipmlpntnstikyllvklqgaslk titlmlrrnnlyvmgysdpydnkcryhifndikgteysdventlcpssnprvakpinyng lyptlekkagvtsrnevqlgiqilssdigkisgqgsftekieakfllvaiqmvseaarfk yienqvktnfnrdfspndkvldleenwgkistaihnskngalpkplelknadgtkwivlr vdeikpdvgllnyvngtcqat
Timeline for d1j1qa_: