SCOP 1.67: Domain d1j1qa_: 1j1q A:

Lineage for d1j1qa_ (1j1q A:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (15 proteins)

6. Protein Antiviral protein S [103333] (1 species)
   seed isoform

7. Species Pokeweed (Phytolacca americana) [TaxId:3527] [103334] (4 PDB entries)

8. Domain d1j1qa_: 1j1q A: [90768]
   complexed with nag

Details for d1j1qa_

PDB Entry: 1j1q, 1.8 Å

PDB Description: structure of pokeweed antiviral protein from seeds (pap-s1)

SCOP Domain Sequences for d1j1qa_:

Sequence; same for both SEQRES and ATOM records:

>d1j1qa_ d.165.1.1 (A:) Antiviral protein S {Pokeweed (Phytolacca americana)}
intitfdagnatinkyatfmeslrneakdpslkcygipmlpntnstikyllvklqgaslk
titlmlrrnnlyvmgysdpydnkcryhifndikgteysdventlcpssnprvakpinyng
lyptlekkagvtsrnevqlgiqilssdigkisgqgsftekieakfllvaiqmvseaarfk
yienqvktnfnrdfspndkvldleenwgkistaihnskngalpkplelknadgtkwivlr
vdeikpdvgllnyvngtcqat

Timeline for d1j1qa_:

• d1j1qa_ is new in SCOP 1.67
  
• d1j1qa_ appears in SCOP 1.69
  
• d1j1qa_ appears in the current release, SCOPe 2.08