SCOPe 2.07: Domain d1iv0a_: 1iv0 A:

Lineage for d1iv0a_ (1iv0 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.8: Putative Holliday junction resolvase RuvX [102485] (3 proteins)
   automatically mapped to Pfam PF03652

6. Protein Hypothetical protein, YqgF homologue [102490] (1 species)

7. Species Thermus thermophilus [TaxId:274] [102491] (1 PDB entry)

8. Domain d1iv0a_: 1iv0 A: [90706]
   N-terminal fragment lacking the C-terminal helix

Details for d1iv0a_

PDB Entry: 1iv0

PDB Description: solution structure of the yqgf-family protein (n-terminal fragment)

PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d1iv0a_:

Sequence; same for both SEQRES and ATOM records:

>d1iv0a_ c.55.3.8 (A:) Hypothetical protein, YqgF homologue {Thermus thermophilus [TaxId: 274]}
mrvgaldvgeariglavgeegvplasgrgylvrktleedvealldfvrreglgklvvglp
lrtdlkesaqagkvlplvealrargvevelwderfttk

Timeline for d1iv0a_:

• d1iv0a_ first appeared in SCOP 1.67
  
• d1iv0a_ appears in SCOPe 2.06
  
• d1iv0a_ appears in the current release, SCOPe 2.08