Lineage for d1irya_ (1iry A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1216197Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 1216198Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 1216199Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 1216200Protein 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 [103207] (1 species)
  7. 1216201Species Human (Homo sapiens) [TaxId:9606] [103208] (1 PDB entry)
  8. 1216202Domain d1irya_: 1iry A: [90690]

Details for d1irya_

PDB Entry: 1iry (more details)

PDB Description: solution structure of the hmth1, a nucleotide pool sanitization enzyme
PDB Compounds: (A:) hMTH1

SCOPe Domain Sequences for d1irya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]}
mgasrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesglt
vdalhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpdd
sywfplllqkkkfhgyfkfqgqdtildytlrevdtv

SCOPe Domain Coordinates for d1irya_:

Click to download the PDB-style file with coordinates for d1irya_.
(The format of our PDB-style files is described here.)

Timeline for d1irya_: