SCOPe 2.05: Domain d1i2aa_: 1i2a A:

Lineage for d1i2aa_ (1i2a A:)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.24: Ribosomal protein L1 [56807] (1 superfamily)
   2 domains: (1) alpha+beta; (2) alpha/beta (interrupts domain 1)

4. Superfamily e.24.1: Ribosomal protein L1 [56808] (1 family)
   automatically mapped to Pfam PF00687

5. Family e.24.1.1: Ribosomal protein L1 [56809] (1 protein)

6. Protein Ribosomal protein L1 [56810] (4 species)

7. Species Methanococcus jannaschii [TaxId:2190] [56812] (3 PDB entries)

8. Domain d1i2aa_: 1i2a A: [90660]
   complexed with ptl

Details for d1i2aa_

PDB Entry: 1i2a, 1.85 Å

PDB Description: crystal structure of l1 ribosomal protein from methanococcus jannaschii with 1.85a resolution.

PDB Compounds: (A:) 50s ribosomal protein l1p

SCOPe Domain Sequences for d1i2aa_:

Sequence; same for both SEQRES and ATOM records:

>d1i2aa_ e.24.1.1 (A:) Ribosomal protein L1 {Methanococcus jannaschii [TaxId: 2190]}
mdreallqavkearelakprnftqsfefiatlkeidmrkpenriktevvlphgrgkeaki
avigtgdlakqaeelgltvirkeeieelgknkrklrkiakahdffiaqadlmpligrymg
vilgprgkmpkpvpananikplverlkktvvintrdkpyfqvlvgnekmtdeqivdniea
vlnvvakkyekglyhikdayvkltmgpavkvk

Timeline for d1i2aa_:

• d1i2aa_ first appeared in SCOP 1.67
  
• d1i2aa_ appears in SCOPe 2.04
  
• d1i2aa_ appears in SCOPe 2.06
  
• d1i2aa_ appears in the current release, SCOPe 2.08