Lineage for d1hkhb_ (1hkh B:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 706658Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 706659Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 707081Family c.69.1.12: Haloperoxidase [53531] (7 proteins)
  6. 707112Protein Gamma-lactamase [102627] (1 species)
    haloperoxidase homologue
  7. 707113Species Aureobacterium sp. [TaxId:51671] [102628] (2 PDB entries)
  8. 707115Domain d1hkhb_: 1hkh B: [90629]
    complexed with so4

Details for d1hkhb_

PDB Entry: 1hkh (more details), 1.73 Å

PDB Description: unligated gamma lactamase from an aureobacterium species
PDB Compounds: (B:) gamma lactamase

SCOP Domain Sequences for d1hkhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hkhb_ c.69.1.12 (B:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]}
gyitvgnenstpielyyedqgsgqpvvlihgypldghswerqtrellaqgyrvitydrrg
fggsskvntgydydtfaadlhtvletldlrdvvlvgfsmgtgelaryvaryghervakla
flaslepflvqrddnpegvpqevfdgieaaakgdrfawftdfyknfynldenlgsriseq
avtgswnvaigsapvaayavvpawiedfrsdveavraagkptlilhgtkdnilpidatar
rfhqavpeadyvevegaphgllwthadevnaalktflak

SCOP Domain Coordinates for d1hkhb_:

Click to download the PDB-style file with coordinates for d1hkhb_.
(The format of our PDB-style files is described here.)

Timeline for d1hkhb_: