SCOPe 2.07: Domain d1hkhb_: 1hkh B:

Lineage for d1hkhb_ (1hkh B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.12: Haloperoxidase [53531] (8 protein domains)
   automatically mapped to Pfam PF12697
   automatically mapped to Pfam PF00561

6. Protein Gamma-lactamase [102627] (1 species)
   haloperoxidase homologue

7. Species Aureobacterium sp. [TaxId:51671] [102628] (2 PDB entries)

8. Domain d1hkhb_: 1hkh B: [90629]
   complexed with so4

Details for d1hkhb_

PDB Entry: 1hkh, 1.73 Å

PDB Description: unligated gamma lactamase from an aureobacterium species

PDB Compounds: (B:) gamma lactamase

SCOPe Domain Sequences for d1hkhb_:

Sequence; same for both SEQRES and ATOM records:

>d1hkhb_ c.69.1.12 (B:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]}
gyitvgnenstpielyyedqgsgqpvvlihgypldghswerqtrellaqgyrvitydrrg
fggsskvntgydydtfaadlhtvletldlrdvvlvgfsmgtgelaryvaryghervakla
flaslepflvqrddnpegvpqevfdgieaaakgdrfawftdfyknfynldenlgsriseq
avtgswnvaigsapvaayavvpawiedfrsdveavraagkptlilhgtkdnilpidatar
rfhqavpeadyvevegaphgllwthadevnaalktflak

Timeline for d1hkhb_:

• d1hkhb_ first appeared in SCOP 1.67
  
• d1hkhb_ appears in SCOPe 2.06