Lineage for d1hkha_ (1hkh A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900586Family c.69.1.12: Haloperoxidase [53531] (8 proteins)
    automatically mapped to Pfam PF12697
    automatically mapped to Pfam PF00561
  6. 2900617Protein Gamma-lactamase [102627] (1 species)
    haloperoxidase homologue
  7. 2900618Species Aureobacterium sp. [TaxId:51671] [102628] (2 PDB entries)
  8. 2900621Domain d1hkha_: 1hkh A: [90628]
    complexed with so4

Details for d1hkha_

PDB Entry: 1hkh (more details), 1.73 Å

PDB Description: unligated gamma lactamase from an aureobacterium species
PDB Compounds: (A:) gamma lactamase

SCOPe Domain Sequences for d1hkha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]}
gyitvgnenstpielyyedqgsgqpvvlihgypldghswerqtrellaqgyrvitydrrg
fggsskvntgydydtfaadlhtvletldlrdvvlvgfsmgtgelaryvaryghervakla
flaslepflvqrddnpegvpqevfdgieaaakgdrfawftdfyknfynldenlgsriseq
avtgswnvaigsapvaayavvpawiedfrsdveavraagkptlilhgtkdnilpidatar
rfhqavpeadyvevegaphgllwthadevnaalktflak

SCOPe Domain Coordinates for d1hkha_:

Click to download the PDB-style file with coordinates for d1hkha_.
(The format of our PDB-style files is described here.)

Timeline for d1hkha_: