Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) |
Family d.14.1.8: Hsp90 middle domain [102755] (1 protein) related to the DNA gyrase/MutL family; contains extra C-terminal alpha/beta subdomain |
Protein Heat shock protein hsp82 [102756] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102757] (3 PDB entries) |
Domain d1hk7a_: 1hk7 A: [90626] |
PDB Entry: 1hk7 (more details), 2.5 Å
SCOP Domain Sequences for d1hk7a_:
Sequence, based on SEQRES records: (download)
>d1hk7a_ d.14.1.8 (A:) Heat shock protein hsp82 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tkplwtrnpsditqeeynafyksisndwedplyvkhfsvegqlefrailfipkrapfdlf eskkkknniklyvrrvfitdeaedlipewlsfvkgvvdsedlplnlsremlqqnkimkvi rknivkklieafneiaedseqfekfysafskniklgvhedtqnraalakllrynstksvd eltsltdyvtrmpehqkniyyitgeslkavekspfldalkaknfevlfltdpideyaftq lkefegktlvditkdf
>d1hk7a_ d.14.1.8 (A:) Heat shock protein hsp82 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tkplwtrnpsditqeeynafyksisndwedplyvkhfsvegqlefrailfipkrapfdlf eskkkknniklyvrrvfitdeaedlipewlsfvkgvvdsedlplnqnkimkvirknivkk lieafneiaedseqfekfysafskniklgvhedtqnraalakllrynstksvdeltsltd yvtrmpehqkniyyitgeslkavekspfldalkaknfevlfltdpideyaftqlkefegk tlvditkdf
Timeline for d1hk7a_: