Lineage for d1hk7a_ (1hk7 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2157367Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2157368Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2157938Family d.14.1.8: Hsp90 middle domain [102755] (2 protein domains)
    related to the DNA gyrase/MutL family; contains extra C-terminal alpha/beta subdomain
    automatically mapped to Pfam PF00183
  6. 2157939Protein Heat shock protein hsp82 [102756] (1 species)
  7. 2157940Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102757] (3 PDB entries)
  8. 2157942Domain d1hk7a_: 1hk7 A: [90626]
    complexed with cd, mg

Details for d1hk7a_

PDB Entry: 1hk7 (more details), 2.5 Å

PDB Description: middle domain of hsp90
PDB Compounds: (A:) heat shock protein hsp82

SCOPe Domain Sequences for d1hk7a_:

Sequence, based on SEQRES records: (download)

>d1hk7a_ d.14.1.8 (A:) Heat shock protein hsp82 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tkplwtrnpsditqeeynafyksisndwedplyvkhfsvegqlefrailfipkrapfdlf
eskkkknniklyvrrvfitdeaedlipewlsfvkgvvdsedlplnlsremlqqnkimkvi
rknivkklieafneiaedseqfekfysafskniklgvhedtqnraalakllrynstksvd
eltsltdyvtrmpehqkniyyitgeslkavekspfldalkaknfevlfltdpideyaftq
lkefegktlvditkdf

Sequence, based on observed residues (ATOM records): (download)

>d1hk7a_ d.14.1.8 (A:) Heat shock protein hsp82 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tkplwtrnpsditqeeynafyksisndwedplyvkhfsvegqlefrailfipkrapfdlf
eskkkknniklyvrrvfitdeaedlipewlsfvkgvvdsedlplnqnkimkvirknivkk
lieafneiaedseqfekfysafskniklgvhedtqnraalakllrynstksvdeltsltd
yvtrmpehqkniyyitgeslkavekspfldalkaknfevlfltdpideyaftqlkefegk
tlvditkdf

SCOPe Domain Coordinates for d1hk7a_:

Click to download the PDB-style file with coordinates for d1hk7a_.
(The format of our PDB-style files is described here.)

Timeline for d1hk7a_: