Lineage for d1h56a_ (1h56 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490159Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2490160Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2490264Family c.52.1.6: Restriction endonuclease PvuII [52996] (2 proteins)
    automatically mapped to Pfam PF09225
  6. 2490265Protein Restriction endonuclease PvuII [52997] (1 species)
  7. 2490266Species Proteus vulgaris [TaxId:585] [52998] (9 PDB entries)
  8. 2490284Domain d1h56a_: 1h56 A: [90620]
    complexed with mg

Details for d1h56a_

PDB Entry: 1h56 (more details), 3 Å

PDB Description: structural and biochemical characterization of a new magnesium ion binding site near tyr94 in the restriction endonuclease pvuii
PDB Compounds: (A:) type II restriction enzyme pvuii

SCOPe Domain Sequences for d1h56a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h56a_ c.52.1.6 (A:) Restriction endonuclease PvuII {Proteus vulgaris [TaxId: 585]}
shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavd
nagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdle
fyydkwerkwysdghkdinnpkipvkyvmehgtkiy

SCOPe Domain Coordinates for d1h56a_:

Click to download the PDB-style file with coordinates for d1h56a_.
(The format of our PDB-style files is described here.)

Timeline for d1h56a_: