|  | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) | 
|  | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest | 
|  | Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families)  | 
|  | Family c.52.1.6: Restriction endonuclease PvuII [52996] (2 proteins) automatically mapped to Pfam PF09225 | 
|  | Protein Restriction endonuclease PvuII [52997] (1 species) | 
|  | Species Proteus vulgaris [TaxId:585] [52998] (9 PDB entries) | 
|  | Domain d1h56a_: 1h56 A: [90620] complexed with mg | 
PDB Entry: 1h56 (more details), 3 Å
SCOPe Domain Sequences for d1h56a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h56a_ c.52.1.6 (A:) Restriction endonuclease PvuII {Proteus vulgaris [TaxId: 585]}
shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavd
nagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdle
fyydkwerkwysdghkdinnpkipvkyvmehgtkiy
Timeline for d1h56a_: