![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.1: Thiolase-related [53902] (20 proteins) |
![]() | Protein Beta-ketoacyl-ACP synthase I, N-terminal domain [419014] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [419486] (19 PDB entries) Uniprot P14926 |
![]() | Domain d1h4fb1: 1h4f B:1-253 [90611] Other proteins in same PDB: d1h4fa2, d1h4fb2, d1h4fc2, d1h4fd2 complexed with nh4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1h4f (more details), 2 Å
SCOPe Domain Sequences for d1h4fb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h4fb1 c.95.1.1 (B:1-253) Beta-ketoacyl-ACP synthase I, N-terminal domain {Escherichia coli [TaxId: 562]} mkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv eelehalargahi
Timeline for d1h4fb1: