Lineage for d1h4fa1 (1h4f A:1-253)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916471Family c.95.1.1: Thiolase-related [53902] (20 proteins)
  6. 2916579Protein Beta-ketoacyl-ACP synthase I, N-terminal domain [419014] (2 species)
  7. 2916580Species Escherichia coli [TaxId:562] [419486] (19 PDB entries)
    Uniprot P14926
  8. 2916637Domain d1h4fa1: 1h4f A:1-253 [90609]
    Other proteins in same PDB: d1h4fa2, d1h4fb2, d1h4fc2, d1h4fd2
    complexed with nh4
    has additional insertions and/or extensions that are not grouped together

Details for d1h4fa1

PDB Entry: 1h4f (more details), 2 Å

PDB Description: e. coli beta-ketoacyl [acyl carrier protein] synthase i k328r
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase I

SCOPe Domain Sequences for d1h4fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4fa1 c.95.1.1 (A:1-253) Beta-ketoacyl-ACP synthase I, N-terminal domain {Escherichia coli [TaxId: 562]}
mkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
eelehalargahi

SCOPe Domain Coordinates for d1h4fa1:

Click to download the PDB-style file with coordinates for d1h4fa1.
(The format of our PDB-style files is described here.)

Timeline for d1h4fa1: