Lineage for d1h39b1 (1h39 B:10-36,B:308-629)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1742882Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1743246Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 1743275Family a.102.4.2: Terpene synthases [48243] (2 proteins)
    consists of two toroid domains: one of six and one of five hairpins
  6. 1743282Protein Squalene-hopene cyclase [48244] (1 species)
  7. 1743283Species Alicyclobacillus acidocaldarius [TaxId:405212] [48245] (16 PDB entries)
  8. 1743352Domain d1h39b1: 1h39 B:10-36,B:308-629 [90570]
    complexed with c8e, r03

Details for d1h39b1

PDB Entry: 1h39 (more details), 2.8 Å

PDB Description: structures of human oxidosqualene cyclase inhibitors bound to an homologous enzyme
PDB Compounds: (B:) squalene--hopene cyclase

SCOPe Domain Sequences for d1h39b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h39b1 a.102.4.2 (B:10-36,B:308-629) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]}
ayartldraveyllscqkdegywwgplXispvwdtglavlalraaglpadhdrlvkagew
lldrqitvpgdwavkrpnlkpggfafqfdnvyypdvddtavvvwalntlrlpderrrrda
mtkgfrwivgmqssnggwgaydvdntsdlpnhipfcdfgevtdppsedvtahvlecfgsf
gyddawkvirraveylkreqkpdgswfgrwgvnylygtgavvsalkavgidtrepyiqka
ldwveqhqnpdggwgedcrsyedpayagkgastpsqtawalmaliaggraeseaarrgvq
ylvetqrpdggwdepyytgtgfpgdfylgytmyrhvfptlalgrykqaie

SCOPe Domain Coordinates for d1h39b1:

Click to download the PDB-style file with coordinates for d1h39b1.
(The format of our PDB-style files is described here.)

Timeline for d1h39b1: