Lineage for d1gxfb3 (1gxf B:358-488)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204289Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2204290Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 2204291Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 2204422Protein Trypanothione reductase [55429] (3 species)
  7. 2204441Species Trypanosoma cruzi [TaxId:5693] [55431] (4 PDB entries)
  8. 2204447Domain d1gxfb3: 1gxf B:358-488 [90532]
    Other proteins in same PDB: d1gxfa1, d1gxfa2, d1gxfb1, d1gxfb2
    complexed with fad, mae, qum

Details for d1gxfb3

PDB Entry: 1gxf (more details), 2.7 Å

PDB Description: crystal structure of trypanosoma cruzi trypanothione reductase in complex with the inhibitor quinacrine mustard
PDB Compounds: (B:) trypanothione reductase (oxidized form)

SCOPe Domain Sequences for d1gxfb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gxfb3 d.87.1.1 (B:358-488) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]}
dhtrvasavfsippigtcglieevaskryevvavylssftplmhkvsgskyktfvakiit
nhsdgtvlgvhllgdnapeiiqgigiclklnakisdfyntigvhptsaeelcsmrtpsyy
yvkgekmekps

SCOPe Domain Coordinates for d1gxfb3:

Click to download the PDB-style file with coordinates for d1gxfb3.
(The format of our PDB-style files is described here.)

Timeline for d1gxfb3: