SCOPe 2.08: Domain d1gxfb1: 1gxf B:5-169,B:287-357

Lineage for d1gxfb1 (1gxf B:5-169,B:287-357)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
   duplication: both domains have similar folds and functions
   most members of the family contain common C-terminal alpha+beta domain

6. Protein Trypanothione reductase, N- and C-terminal domain [418954] (3 species)

7. Species Trypanosoma cruzi [TaxId:5693] [419414] (4 PDB entries)

8. Domain d1gxfb1: 1gxf B:5-169,B:287-357 [90530]
   Other proteins in same PDB: d1gxfa2, d1gxfa3, d1gxfb2, d1gxfb3
   complexed with fad, mae, qum
   has additional insertions and/or extensions that are not grouped together

Details for d1gxfb1

PDB Entry: 1gxf, 2.7 Å

PDB Description: crystal structure of trypanosoma cruzi trypanothione reductase in complex with the inhibitor quinacrine mustard

PDB Compounds: (B:) trypanothione reductase (oxidized form)

SCOPe Domain Sequences for d1gxfb1:

Sequence; same for both SEQRES and ATOM records:

>d1gxfb1 c.3.1.5 (B:5-169,B:287-357) Trypanothione reductase, N- and C-terminal domain {Trypanosoma cruzi [TaxId: 5693]}
ifdlvvigagsggleaawnaatlykkrvavidvqmvhgppffsalggtcvnvgcvpkklm
vtgaqymehlresagfgwefdrttlraewknliavkdeavlninksydemfrdtegleff
lgwgslesknvvnvresadpasavkerletehillasgswphmpnXgrsprtkdlqlqna
gvmiknggvqvdeysrtnvsniyaigdvtnrvmltpvaineaaalvdtvfgttprkt

Timeline for d1gxfb1:

• d1gxfb1 first appeared in SCOP 1.67
  
• d1gxfb1 appears in SCOPe 2.07