SCOPe 2.03: Domain d1gtwb_: 1gtw B:

Lineage for d1gtwb_ (1gtw B:)

1. Root: SCOPe 2.03

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.3: Leucine zipper domain [57959] (1 family)

5. Family h.1.3.1: Leucine zipper domain [57960] (16 proteins)

6. Protein C/ebp beta [57985] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64590] (10 PDB entries)

8. Domain d1gtwb_: 1gtw B: [90524]
   homodimer
   protein/DNA complex

Details for d1gtwb_

PDB Entry: 1gtw, 1.85 Å

PDB Description: crystal structure of C/EBPbeta bZip homodimer bound to a DNA fragment from the tom-1A promoter

PDB Compounds: (B:) caat/enhancer binding protein beta

SCOPe Domain Sequences for d1gtwb_:

Sequence; same for both SEQRES and ATOM records:

>d1gtwb_ h.1.3.1 (B:) C/ebp beta {Human (Homo sapiens) [TaxId: 9606]}
dkhsdeykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrelstl
rnlfkqlp

Timeline for d1gtwb_:

• d1gtwb_ first appeared in SCOP 1.67
  
• d1gtwb_ appears in SCOPe 2.02
  
• d1gtwb_ appears in SCOPe 2.04
  
• d1gtwb_ appears in the current release, SCOPe 2.08