Lineage for d1gtwb_ (1gtw B:)

  1. Root: SCOP 1.67
  2. 431023Class h: Coiled coil proteins [57942] (6 folds)
  3. 431024Fold h.1: Parallel coiled-coil [57943] (27 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 431178Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 431179Family h.1.3.1: Leucine zipper domain [57960] (14 proteins)
  6. 431205Protein C/ebp beta [57985] (2 species)
  7. 431206Species Human (Homo sapiens) [TaxId:9606] [64590] (8 PDB entries)
  8. 431210Domain d1gtwb_: 1gtw B: [90524]
    homodimer

Details for d1gtwb_

PDB Entry: 1gtw (more details), 1.85 Å

PDB Description: crystal structure of C/EBPbeta bZip homodimer bound to a DNA fragment from the tom-1A promoter

SCOP Domain Sequences for d1gtwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtwb_ h.1.3.1 (B:) C/ebp beta {Human (Homo sapiens)}
dkhsdeykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrelstl
rnlfkqlp

SCOP Domain Coordinates for d1gtwb_:

Click to download the PDB-style file with coordinates for d1gtwb_.
(The format of our PDB-style files is described here.)

Timeline for d1gtwb_:

431210
d1gtwb_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1gtwa_