Lineage for d1gt1b_ (1gt1 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2413761Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2414184Protein Odorant-binding protein [50821] (2 species)
    C-termini swapping dimer
  7. 2414185Species Cow (Bos taurus) [TaxId:9913] [50822] (8 PDB entries)
  8. 2414195Domain d1gt1b_: 1gt1 B: [90516]
    complexed with 3om, anc, prz

Details for d1gt1b_

PDB Entry: 1gt1 (more details), 1.71 Å

PDB Description: complex of bovine odorant binding protein with aminoanthracene and pyrazine
PDB Compounds: (B:) odorant-binding protein

SCOPe Domain Sequences for d1gt1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gt1b_ b.60.1.1 (B:) Odorant-binding protein {Cow (Bos taurus) [TaxId: 9913]}
eeeaeqnlselsgpwrtvyigstnpekiqengpfrtyfrelvfddekgtvdfyfsvkrdg
kwknvhvkatkqddgtyvadyegqnvfkivslsrthlvahninvdkhgqtteltelfvkl
nvededlekfwkltedkgidkknvvnflenenhphp

SCOPe Domain Coordinates for d1gt1b_:

Click to download the PDB-style file with coordinates for d1gt1b_.
(The format of our PDB-style files is described here.)

Timeline for d1gt1b_: