Class b: All beta proteins [48724] (178 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
Protein Odorant-binding protein [50821] (2 species) C-termini swapping dimer |
Species Cow (Bos taurus) [TaxId:9913] [50822] (8 PDB entries) |
Domain d1gt1b_: 1gt1 B: [90516] complexed with 3om, anc, prz |
PDB Entry: 1gt1 (more details), 1.71 Å
SCOPe Domain Sequences for d1gt1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gt1b_ b.60.1.1 (B:) Odorant-binding protein {Cow (Bos taurus) [TaxId: 9913]} eeeaeqnlselsgpwrtvyigstnpekiqengpfrtyfrelvfddekgtvdfyfsvkrdg kwknvhvkatkqddgtyvadyegqnvfkivslsrthlvahninvdkhgqtteltelfvkl nvededlekfwkltedkgidkknvvnflenenhphp
Timeline for d1gt1b_: