Lineage for d1gqna_ (1gqn A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1147695Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1147696Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 1148192Protein Type I 3-dehydroquinate dehydratase [51586] (2 species)
  7. 1148193Species Salmonella typhi [TaxId:90370] [51587] (3 PDB entries)
  8. 1148194Domain d1gqna_: 1gqn A: [90514]

Details for d1gqna_

PDB Entry: 1gqn (more details), 1.78 Å

PDB Description: native 3-dehydroquinase from salmonella typhi
PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d1gqna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gqna_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]}
mktvtvknliigegmpkiivslmgrdinsvkaealayreatfdilewrvdhfmdiastqs
vltaarvirdampdipllftfrsakeggeqtittqhyltlnraaidsglvdmidlelftg
dadvkatvdyahahnvyvvmsnhdfhqtpsaeemvsrlrkmqalgadipkiavmpqskhd
vltlltatlemqqhyadrpvitmsmakegvisrlagevfgsaatfgavkqasapgqiavn
dlrsvlmilhna

SCOPe Domain Coordinates for d1gqna_:

Click to download the PDB-style file with coordinates for d1gqna_.
(The format of our PDB-style files is described here.)

Timeline for d1gqna_: