Lineage for d1jeqa4 (1jeq A:35-253)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144673Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2144674Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2144869Family c.62.1.3: Ku70 subunit N-terminal domain [100959] (1 protein)
    automatically mapped to Pfam PF03731
  6. 2144870Protein Ku70 subunit N-terminal domain [100960] (1 species)
  7. 2144871Species Human (Homo sapiens) [TaxId:9606] [100961] (2 PDB entries)
  8. 2144873Domain d1jeqa4: 1jeq A:35-253 [90367]
    Other proteins in same PDB: d1jeqa1, d1jeqa3, d1jeqb1, d1jeqb2

Details for d1jeqa4

PDB Entry: 1jeq (more details), 2.7 Å

PDB Description: crystal structure of the ku heterodimer
PDB Compounds: (A:) Ku70

SCOPe Domain Sequences for d1jeqa4:

Sequence, based on SEQRES records: (download)

>d1jeqa4 c.62.1.3 (A:35-253) Ku70 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
rdsliflvdaskamfesqsedeltpfdmsiqciqsvyiskiissdrdllavvfygtekdk
nsvnfkniyvlqeldnpgakrileldqfkgqqgqkrfqdmmghgsdyslsevlwvcanlf
sdvqfkmshkrimlftnednphgndsakasrartkagdlrdtgifldlmhlkkpggfdis
lfyrdiisiaededlrvhfeesskledllrkvraketrk

Sequence, based on observed residues (ATOM records): (download)

>d1jeqa4 c.62.1.3 (A:35-253) Ku70 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
rdsliflvdaskamfesqsedeltpfdmsiqciqsvyiskiissdrdllavvfygtekdk
nsvnfkniyvlqeldnpgakrileldqfkgqqgqkrfqdmmghgsdyslsevlwvcanlf
sdvqfkmshkrimlftnednphgndsakasrartkagdlrdtgifldlmhlkkpggfdis
lfyrdiisivhfeesskledllrkvraketrk

SCOPe Domain Coordinates for d1jeqa4:

Click to download the PDB-style file with coordinates for d1jeqa4.
(The format of our PDB-style files is described here.)

Timeline for d1jeqa4: