Lineage for d1hx8a2 (1hx8 A:22-161)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 542684Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 543124Superfamily a.118.9: ENTH/VHS domain [48464] (4 families) (S)
  5. 543172Family a.118.9.3: Phosphoinositide-binding clathrin adaptor, N-terminal domain [100911] (2 proteins)
  6. 543173Protein AP180 (Lap) [100914] (1 species)
  7. 543174Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [100915] (1 PDB entry)
  8. 543175Domain d1hx8a2: 1hx8 A:22-161 [90363]
    Other proteins in same PDB: d1hx8a1, d1hx8b1

Details for d1hx8a2

PDB Entry: 1hx8 (more details), 2.2 Å

PDB Description: crystal structure of n-terminal domain of drosophila ap180

SCOP Domain Sequences for d1hx8a2:

Sequence, based on SEQRES records: (download)

>d1hx8a2 a.118.9.3 (A:22-161) AP180 (Lap) {Fruit fly (Drosophila melanogaster)}
qglaksvckatteecigpkkkhldylvhcanepnvsiphlanlliersqnanwvvvyksl
itthhlmaygnerfmqylassnstfnlssfldkgtvqdggmgvpggrmgydmspfirrya
kylnekslsyramafdfckv

Sequence, based on observed residues (ATOM records): (download)

>d1hx8a2 a.118.9.3 (A:22-161) AP180 (Lap) {Fruit fly (Drosophila melanogaster)}
qglaksvckatteecigpkkkhldylvhcanepnvsiphlanlliersqnanwvvvyksl
itthhlmaygnerfmqylassnstfnlssfldkgtggmgvpggrmgydmspfirryakyl
nekslsyramafdfckv

SCOP Domain Coordinates for d1hx8a2:

Click to download the PDB-style file with coordinates for d1hx8a2.
(The format of our PDB-style files is described here.)

Timeline for d1hx8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hx8a1