Lineage for d1hx8a1 (1hx8 A:167-299)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1261318Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1261567Superfamily a.7.8: GAT-like domain [89009] (3 families) (S)
  5. 1261588Family a.7.8.2: Phosphoinositide-binding clathrin adaptor, domain 2 [100929] (2 proteins)
    this domain is associated with the N-terminal ENTH-like domain
  6. 1261589Protein AP180 (Lap) [100932] (1 species)
  7. 1261590Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [100933] (1 PDB entry)
  8. 1261591Domain d1hx8a1: 1hx8 A:167-299 [90362]
    Other proteins in same PDB: d1hx8a2, d1hx8b2
    complexed with so4

Details for d1hx8a1

PDB Entry: 1hx8 (more details), 2.2 Å

PDB Description: crystal structure of n-terminal domain of drosophila ap180
PDB Compounds: (A:) synapse-enriched clathrin adaptor protein lap

SCOPe Domain Sequences for d1hx8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hx8a1 a.7.8.2 (A:167-299) AP180 (Lap) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
egslrsmnaekllktlpvlqaqldallefdcqsndlsngvinmsfmllfrdlirlfacyn
dgiinllekyfdmnkkhardaldlykkflvrmdrvgeflkvaenvgidkgdipdltkaps
slldaleqhlatl

SCOPe Domain Coordinates for d1hx8a1:

Click to download the PDB-style file with coordinates for d1hx8a1.
(The format of our PDB-style files is described here.)

Timeline for d1hx8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hx8a2