Lineage for d1fvka_ (1fvk A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991973Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 991974Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 993420Family c.47.1.13: DsbA-like [100953] (4 proteins)
    contains an all-alpha subdomain insertion
  6. 993421Protein Disulfide-bond formation facilitator (DsbA) [100954] (3 species)
    the insert subdomain is a 4-helical bundle
  7. 993422Species Escherichia coli [TaxId:562] [100955] (15 PDB entries)
  8. 993423Domain d1fvka_: 1fvk A: [90351]

Details for d1fvka_

PDB Entry: 1fvk (more details), 1.7 Å

PDB Description: the 1.7 angstrom structure of wild type disulfide bond formation protein (dsba)
PDB Compounds: (A:) disulfide bond formation protein

SCOPe Domain Sequences for d1fvka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fvka_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]}
aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
tvkylsek

SCOPe Domain Coordinates for d1fvka_:

Click to download the PDB-style file with coordinates for d1fvka_.
(The format of our PDB-style files is described here.)

Timeline for d1fvka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fvkb_