SCOPe 2.08: Domain d1dkxa1: 1dkx A:507-607

Lineage for d1dkxa1 (1dkx A:507-607)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.4: Heat shock protein 70kD (HSP70), C-terminal subdomain [100934] (2 families)

5. Family a.8.4.1: Heat shock protein 70kD (HSP70), C-terminal subdomain [100935] (3 proteins)

6. Protein DnaK [100936] (2 species)

7. Species Escherichia coli [TaxId:562] [100937] (3 PDB entries)

8. Domain d1dkxa1: 1dkx A:507-607 [90339]
   Other proteins in same PDB: d1dkxa2
   complexed with peptide, chain B
   protein/DNA complex

Details for d1dkxa1

PDB Entry: 1dkx, 2 Å

PDB Description: the substrate binding domain of dnak in complex with a substrate peptide, determined from type 1 selenomethionyl crystals

PDB Compounds: (A:) substrate binding domain of dnak

SCOPe Domain Sequences for d1dkxa1:

Sequence; same for both SEQRES and ATOM records:

>d1dkxa1 a.8.4.1 (A:507-607) DnaK {Escherichia coli [TaxId: 562]}
lnedeiqkmvrdaeanaeadrkfdelvqtrnqgdhllhstrkqveeagdklpaddktaie
saltaletalkgedkaaieakmqelaqvsqklmeiaqqqha

Timeline for d1dkxa1:

• d1dkxa1 first appeared in SCOP 1.67
  
• d1dkxa1 appears in SCOPe 2.07