SCOPe 2.05: Domain d2e2aa_: 2e2a A:

Lineage for d2e2aa_ (2e2a A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.2: Enzyme IIa from lactose specific PTS, IIa-lac [46973] (2 families)

5. Family a.7.2.1: Enzyme IIa from lactose specific PTS, IIa-lac [46974] (1 protein)
   form trimers with 9 helices in a bundle
   automatically mapped to Pfam PF02255
   this is a repeat family; one repeat unit is 2e2a A: found in domain

6. Protein Enzyme IIa from lactose specific PTS, IIa-lac [46975] (1 species)

7. Species Lactococcus lactis [TaxId:1358] [46976] (2 PDB entries)

8. Domain d2e2aa_: 2e2a A: [88499]

Details for d2e2aa_

PDB Entry: 2e2a, 2.1 Å

PDB Description: asp81leu enzyme iia from the lactose specific pts from lactococcus lactis

PDB Compounds: (A:) protein (enzyme iia)

SCOPe Domain Sequences for d2e2aa_:

Sequence; same for both SEQRES and ATOM records:

>d2e2aa_ a.7.2.1 (A:) Enzyme IIa from lactose specific PTS, IIa-lac {Lactococcus lactis [TaxId: 1358]}
mnreemtllgfeivayagdarskllealkaaengdfakadslvveagsciaeahssqtgm
lareasgeelpysvtmmhgqlhlmttillkdvihhlielykrga

Timeline for d2e2aa_:

• d2e2aa_ first appeared in SCOP 1.65
  
• d2e2aa_ appears in SCOPe 2.04
  
• d2e2aa_ appears in SCOPe 2.06
  
• d2e2aa_ appears in the current release, SCOPe 2.08