Lineage for d1ufhb_ (1ufh B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574993Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2574994Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2574995Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2575311Protein Putative acetyltransferase YycN [90011] (1 species)
  7. 2575312Species Bacillus subtilis [TaxId:1423] [90012] (2 PDB entries)
  8. 2575318Domain d1ufhb_: 1ufh B: [88486]
    structural genomics

Details for d1ufhb_

PDB Entry: 1ufh (more details), 2.2 Å

PDB Description: structure of putative acetyltransferase, yycn protein of bacillus subtilis
PDB Compounds: (B:) YycN protein

SCOPe Domain Sequences for d1ufhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ufhb_ d.108.1.1 (B:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]}
imltpmqteefrsyltyttkhyaeekvkagtwlpedaqllskqvftdllprgletphhhl
wslklnekdivgwlwihaepehpqqeafiydfglyepyrgkgyakqalaaldqaarsmgi
rklslhvfahnqtarklyeqtgfqetdvvmskkl

SCOPe Domain Coordinates for d1ufhb_:

Click to download the PDB-style file with coordinates for d1ufhb_.
(The format of our PDB-style files is described here.)

Timeline for d1ufhb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ufha_