Lineage for d1ueka2 (1uek A:149-268)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 505236Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (7 families) (S)
    common fold is elaborated with additional secondary structures
  5. 505274Family d.58.26.5: 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE [89950] (1 protein)
  6. 505275Protein 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE [89951] (2 species)
  7. 505279Species Thermus thermophilus [TaxId:274] [89952] (1 PDB entry)
  8. 505280Domain d1ueka2: 1uek A:149-268 [88484]
    Other proteins in same PDB: d1ueka1

Details for d1ueka2

PDB Entry: 1uek (more details), 1.7 Å

PDB Description: Crystal structure of 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase

SCOP Domain Sequences for d1ueka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ueka2 d.58.26.5 (A:149-268) 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE {Thermus thermophilus}
lppvpavvffpglrvptplvyravrpedfgpdlpveailealargeeppywnslegpafr
lfpelkevrgrmralglrgvlmsgsgsaffglaegpdharraaealrawgrawagtlggg

SCOP Domain Coordinates for d1ueka2:

Click to download the PDB-style file with coordinates for d1ueka2.
(The format of our PDB-style files is described here.)

Timeline for d1ueka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ueka1