SCOPe 2.07: Domain d1ub4a_: 1ub4 A:

Lineage for d1ub4a_ (1ub4 A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families)
   contains insert beta-sheet subdomain and C-terminal helix

5. Family b.34.6.2: Kid/PemK [82075] (4 proteins)
   automatically mapped to Pfam PF02452

6. Protein MazF protein [89303] (1 species)

7. Species Escherichia coli [TaxId:562] [89304] (2 PDB entries)

8. Domain d1ub4a_: 1ub4 A: [88399]
   Other proteins in same PDB: d1ub4c_
   complexed with the antidote protein MazE
   protein/DNA complex

Details for d1ub4a_

PDB Entry: 1ub4, 1.7 Å

PDB Description: crystal structure of mazef complex

PDB Compounds: (A:) MazF protein

SCOPe Domain Sequences for d1ub4a_:

Sequence, based on SEQRES records:

>d1ub4a_ b.34.6.2 (A:) MazF protein {Escherichia coli [TaxId: 562]}
vsryvpdmgdliwvdfdptkgseqaghrpavvlspfmynnktgmclcvpcttqskgypfe
vvlsgqerdgvaladqvksiawrargatkkgtvapeelqlikakinvlig

Sequence, based on observed residues (ATOM records):

>d1ub4a_ b.34.6.2 (A:) MazF protein {Escherichia coli [TaxId: 562]}
vsryvpdmgdliwvdfdpghrpavvlspfmynnktgmclcvpcttqskgypfevvlsgqe
rdgvaladqvksiawrargatkkgtvapeelqlikakinvlig

Timeline for d1ub4a_:

• d1ub4a_ first appeared in SCOP 1.65
  
• d1ub4a_ appears in SCOPe 2.06
  
• d1ub4a_ appears in the current release, SCOPe 2.08