Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families) contains insert beta-sheet subdomain and C-terminal helix |
Family b.34.6.2: Kid/PemK [82075] (4 proteins) automatically mapped to Pfam PF02452 |
Protein MazF protein [89303] (1 species) |
Species Escherichia coli [TaxId:562] [89304] (2 PDB entries) |
Domain d1ub4a_: 1ub4 A: [88399] Other proteins in same PDB: d1ub4c_ complexed with the antidote protein MazE protein/DNA complex |
PDB Entry: 1ub4 (more details), 1.7 Å
SCOPe Domain Sequences for d1ub4a_:
Sequence, based on SEQRES records: (download)
>d1ub4a_ b.34.6.2 (A:) MazF protein {Escherichia coli [TaxId: 562]} vsryvpdmgdliwvdfdptkgseqaghrpavvlspfmynnktgmclcvpcttqskgypfe vvlsgqerdgvaladqvksiawrargatkkgtvapeelqlikakinvlig
>d1ub4a_ b.34.6.2 (A:) MazF protein {Escherichia coli [TaxId: 562]} vsryvpdmgdliwvdfdpghrpavvlspfmynnktgmclcvpcttqskgypfevvlsgqe rdgvaladqvksiawrargatkkgtvapeelqlikakinvlig
Timeline for d1ub4a_: