![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
![]() | Protein Deoxyribose-phosphate aldolase DeoC [69394] (6 species) |
![]() | Species Thermus thermophilus [TaxId:274] [89492] (2 PDB entries) |
![]() | Domain d1ub3b_: 1ub3 B: [88396] structural genomics complexed with hpd |
PDB Entry: 1ub3 (more details), 1.4 Å
SCOPe Domain Sequences for d1ub3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ub3b_ c.1.10.1 (B:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} mdlaahidhtllkptatleevakaaeealeygfyglcippsyvawvraryphapfrlvtv vgfplgyqekevkaleaalacargadevdmvlhlgrakagdldyleaevravreavpqav lkviletgyfspeeiarlaeaairggadflktstgfgprgasledvallvrvaqgraqvk aaggirdretalrmlkagasrlgtssgvalv
Timeline for d1ub3b_: