SCOP 1.67: Domain d1px7a2: 1px7 A:1-76

Lineage for d1px7a2 (1px7 A:1-76)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (14 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)

6. Protein Class pi GST [81358] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52864] (36 PDB entries)

8. Domain d1px7a2: 1px7 A:1-76 [88338]
   Other proteins in same PDB: d1px7a1, d1px7b1

Details for d1px7a2

PDB Entry: 1px7, 2.03 Å

PDB Description: a folding mutant of human class pi glutathione transferase, created by mutating aspartate 153 of the wild-type protein to glutamate

SCOP Domain Sequences for d1px7a2:

Sequence; same for both SEQRES and ATOM records:

>d1px7a2 c.47.1.5 (A:1-76) Class pi GST {Human (Homo sapiens)}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtl

Timeline for d1px7a2:

• d1px7a2 first appeared in SCOP 1.65
  
• d1px7a2 appears in SCOP 1.69
  
• d1px7a2 appears in the current release, SCOPe 2.08