Lineage for d1px7a2 (1px7 A:1-76)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 315307Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 315308Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 315468Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins)
  6. 315664Protein Class pi GST [81358] (3 species)
  7. 315665Species Human (Homo sapiens) [TaxId:9606] [52864] (35 PDB entries)
  8. 315687Domain d1px7a2: 1px7 A:1-76 [88338]
    Other proteins in same PDB: d1px7a1, d1px7b1

Details for d1px7a2

PDB Entry: 1px7 (more details), 2.03 Å

PDB Description: a folding mutant of human class pi glutathione transferase, created by mutating aspartate 153 of the wild-type protein to glutamate

SCOP Domain Sequences for d1px7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1px7a2 c.47.1.5 (A:1-76) Class pi GST {Human (Homo sapiens)}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtl

SCOP Domain Coordinates for d1px7a2:

Click to download the PDB-style file with coordinates for d1px7a2.
(The format of our PDB-style files is described here.)

Timeline for d1px7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1px7a1