Lineage for d1pv4a2 (1pv4 A:48-126)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1541119Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1541496Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1541712Protein Rho termination factor, RNA-binding domain [68910] (1 species)
  7. 1541713Species Escherichia coli [TaxId:562] [68911] (9 PDB entries)
    Uniprot P03002
  8. 1541738Domain d1pv4a2: 1pv4 A:48-126 [88296]
    Other proteins in same PDB: d1pv4a1, d1pv4a3, d1pv4b2, d1pv4c1, d1pv4c3, d1pv4d1, d1pv4d3, d1pv4e1, d1pv4e3, d1pv4f1, d1pv4f3
    protein/DNA complex

Details for d1pv4a2

PDB Entry: 1pv4 (more details), 3 Å

PDB Description: x-ray crystal structure of the rho transcription termination factor in complex with single stranded dna
PDB Compounds: (A:) transcription termination factor rho

SCOPe Domain Sequences for d1pv4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pv4a2 b.40.4.5 (A:48-126) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]}
difgdgvleilqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkeg
eryfallkvnevnfdkpen

SCOPe Domain Coordinates for d1pv4a2:

Click to download the PDB-style file with coordinates for d1pv4a2.
(The format of our PDB-style files is described here.)

Timeline for d1pv4a2: