SCOP 1.69: Domain d1psub_: 1psu B:

Lineage for d1psub_ (1psu B:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (6 families)

5. Family d.38.1.5: PaaI/YdiI-like [89902] (8 proteins)

6. Protein Phenylacetic acid degradation protein PaaI [89903] (2 species)

7. Species Escherichia coli [TaxId:562] [89904] (1 PDB entry)

8. Domain d1psub_: 1psu B: [88286]
   structural genomics

Details for d1psub_

PDB Entry: 1psu, 2.2 Å

PDB Description: structure of the e. coli paai protein from the phyenylacetic acid degradation operon

SCOP Domain Sequences for d1psub_:

Sequence; same for both SEQRES and ATOM records:

>d1psub_ d.38.1.5 (B:) Phenylacetic acid degradation protein PaaI {Escherichia coli}
mshkawqnahamyendacakalgidiismdegfavvtmtvtaqmlnghqschggqlfsla
dtafayacnsqglaavasactidflrpgfagdtltataqvrhqgkqtgvydieivnqqqk
tvalfrgkshriggtit

Timeline for d1psub_:

• d1psub_ first appeared in SCOP 1.65
  
• d1psub_ appears in SCOP 1.67
  
• d1psub_ appears in SCOP 1.71
  
• d1psub_ appears in the current release, SCOPe 2.08