![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (5 families) ![]() |
![]() | Family d.38.1.5: PaaI/YdiI-like [89902] (2 proteins) |
![]() | Protein Phenylacetic acid degradation protein PaaI [89903] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [89904] (1 PDB entry) |
![]() | Domain d1psub_: 1psu B: [88286] structural genomics complexed with mse |
PDB Entry: 1psu (more details), 2.2 Å
SCOP Domain Sequences for d1psub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1psub_ d.38.1.5 (B:) Phenylacetic acid degradation protein PaaI {Escherichia coli} mshkawqnahamyendacakalgidiismdegfavvtmtvtaqmlnghqschggqlfsla dtafayacnsqglaavasactidflrpgfagdtltataqvrhqgkqtgvydieivnqqqk tvalfrgkshriggtit
Timeline for d1psub_: