Lineage for d1psub_ (1psu B:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 327792Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 327793Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (5 families) (S)
  5. 327826Family d.38.1.5: PaaI/YdiI-like [89902] (2 proteins)
  6. 327831Protein Phenylacetic acid degradation protein PaaI [89903] (1 species)
  7. 327832Species Escherichia coli [TaxId:562] [89904] (1 PDB entry)
  8. 327834Domain d1psub_: 1psu B: [88286]
    structural genomics
    complexed with mse

Details for d1psub_

PDB Entry: 1psu (more details), 2.2 Å

PDB Description: structure of the e. coli paai protein from the phyenylacetic acid degradation operon

SCOP Domain Sequences for d1psub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1psub_ d.38.1.5 (B:) Phenylacetic acid degradation protein PaaI {Escherichia coli}
mshkawqnahamyendacakalgidiismdegfavvtmtvtaqmlnghqschggqlfsla
dtafayacnsqglaavasactidflrpgfagdtltataqvrhqgkqtgvydieivnqqqk
tvalfrgkshriggtit

SCOP Domain Coordinates for d1psub_:

Click to download the PDB-style file with coordinates for d1psub_.
(The format of our PDB-style files is described here.)

Timeline for d1psub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1psua_