Lineage for d1pnyu_ (1pny U:)

  1. Root: SCOPe 2.02
  2. 1248417Class i: Low resolution protein structures [58117] (25 folds)
  3. 1248418Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1248419Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1248420Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1248421Protein 70S ribosome functional complex [58121] (9 species)
  7. 1248493Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 1248782Domain d1pnyu_: 1pny U: [88271]
    50S subunit; the coordinates of 30S subunit in 1pnx
    protein/RNA complex

Details for d1pnyu_

PDB Entry: 1pny (more details), 9.5 Å

PDB Description: crystal structure of the wild type ribosome from e. coli, 50s subunit of 70s ribosome. this file, 1pny, contains only molecules of the 50s ribosomal subunit. the 30s subunit is in the pdb file 1pnx.
PDB Compounds: (U:) 50S ribosomal protein L27

SCOPe Domain Sequences for d1pnyu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnyu_ i.1.1.1 (U:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfa
lsdgkvvfinkgkgarfisieaaqte

SCOPe Domain Coordinates for d1pnyu_:

Click to download the PDB-style file with coordinates for d1pnyu_.
(The format of our PDB-style files is described here.)

Timeline for d1pnyu_: