Lineage for d1ph2a1 (1ph2 A:36-204)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1541119Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1541191Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
    barrel, closed; n=5, S=10
  6. 1541330Protein Telomere end binding protein alpha subunit [50273] (1 species)
    duplication: consists of three domains of this fold
  7. 1541331Species Oxytricha nova [TaxId:200597] [50274] (16 PDB entries)
  8. 1541380Domain d1ph2a1: 1ph2 A:36-204 [88079]
    Other proteins in same PDB: d1ph2b_
    protein/DNA complex; complexed with cl, na

Details for d1ph2a1

PDB Entry: 1ph2 (more details), 3.1 Å

PDB Description: crystal structure of the oxytricha nova telomere end-binding protein complexed with noncognate ssdna ggggttttg
PDB Compounds: (A:) Telomere-binding protein alpha subunit

SCOPe Domain Sequences for d1ph2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ph2a1 b.40.4.3 (A:36-204) Telomere end binding protein alpha subunit {Oxytricha nova [TaxId: 200597]}
yeyvelakasltsaqpqhfyavvidatfpyktnqeryicslkivdptlylkqqkgagdas
dyatlvlyakrfedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkrs
vtqeinnqdavsdttpfsfsskhatiekneisilqnlrkwanqyfssys

SCOPe Domain Coordinates for d1ph2a1:

Click to download the PDB-style file with coordinates for d1ph2a1.
(The format of our PDB-style files is described here.)

Timeline for d1ph2a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ph2b_