SCOPe 2.05: Domain d1pf3a1: 1pf3 A:31-170

Lineage for d1pf3a1 (1pf3 A:31-170)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein multi-copper oxidase CueO [69194] (1 species)

7. Species Escherichia coli [TaxId:562] [69195] (29 PDB entries)

8. Domain d1pf3a1: 1pf3 A:31-170 [88049]
   complexed with c2c, cu; mutant

Details for d1pf3a1

PDB Entry: 1pf3, 1.5 Å

PDB Description: crystal structure of the m441l mutant of the multicopper oxidase cueo

PDB Compounds: (A:) Blue copper oxidase cueO

SCOPe Domain Sequences for d1pf3a1:

Sequence; same for both SEQRES and ATOM records:

>d1pf3a1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}
rptlpipdllttdarnriqltigagqstfggktattwgyngnllgpavklqrgkavtvdi
ynqlteettlhwhglevpgevdggpqgiippggkrsvtlnvdqpaatcwfhphqhgktgr
qvamglaglvvieddeilkl

Timeline for d1pf3a1:

• d1pf3a1 first appeared in SCOP 1.65
  
• d1pf3a1 appears in SCOPe 2.04
  
• d1pf3a1 appears in SCOPe 2.06
  
• d1pf3a1 appears in the current release, SCOPe 2.08