Lineage for d1pe0a_ (1pe0 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1158036Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1160006Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 1160148Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 1160149Protein DJ-1 [89603] (1 species)
    RNA-binding protein regulatory subunit
  7. 1160150Species Human (Homo sapiens) [TaxId:9606] [89604] (25 PDB entries)
    Uniprot Q99497
  8. 1160172Domain d1pe0a_: 1pe0 A: [88045]
    mutant

Details for d1pe0a_

PDB Entry: 1pe0 (more details), 1.7 Å

PDB Description: crystal structure of the k130r mutant of human dj-1
PDB Compounds: (A:) dj-1

SCOPe Domain Sequences for d1pe0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pe0a_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]}
askralvilakgaeemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasleda
kkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfgs
kvtthplardkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaqv
kaplvlk

SCOPe Domain Coordinates for d1pe0a_:

Click to download the PDB-style file with coordinates for d1pe0a_.
(The format of our PDB-style files is described here.)

Timeline for d1pe0a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pe0b_