Lineage for d1pdwh_ (1pdw H:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 578575Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 579489Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (6 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 579594Family c.23.16.2: DJ-1/PfpI [52325] (7 proteins)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 579595Protein DJ-1 [89603] (1 species)
    RNA-binding protein regulatory subunit
  7. 579596Species Human (Homo sapiens) [TaxId:9606] [89604] (9 PDB entries)
  8. 579613Domain d1pdwh_: 1pdw H: [88044]
    complexed with mse

Details for d1pdwh_

PDB Entry: 1pdw (more details), 2.2 Å

PDB Description: Crystal structure of human DJ-1, P 1 21 1 space group

SCOP Domain Sequences for d1pdwh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pdwh_ c.23.16.2 (H:) DJ-1 {Human (Homo sapiens)}
askralvilakgaeemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasleda
kkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfgs
kvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaqv
kaplvlk

SCOP Domain Coordinates for d1pdwh_:

Click to download the PDB-style file with coordinates for d1pdwh_.
(The format of our PDB-style files is described here.)

Timeline for d1pdwh_: