| Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
| Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (7 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different costituent families contain different additional structures |
| Family c.23.16.2: DJ-1/PfpI [52325] (3 proteins) contains a catalytic Cys-His-Glu triad that differs from the class I GAT triad |
| Protein DJ-1 [89603] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [89604] (3 PDB entries) |
| Domain d1pdwh_: 1pdw H: [88044] complexed with mse |
PDB Entry: 1pdw (more details), 2.2 Å
SCOP Domain Sequences for d1pdwh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pdwh_ c.23.16.2 (H:) DJ-1 {Human (Homo sapiens)}
askralvilakgaeemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasleda
kkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfgs
kvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaqv
kaplvlk
Timeline for d1pdwh_: