SCOP 1.65: Domain d1pdwc_: 1pdw C:

Lineage for d1pdwc_ (1pdw C:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (7 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different costituent families contain different additional structures

5. Family c.23.16.2: DJ-1/PfpI [52325] (3 proteins)
   contains a catalytic Cys-His-Glu triad that differs from the class I GAT triad

6. Protein DJ-1 [89603] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89604] (3 PDB entries)

8. Domain d1pdwc_: 1pdw C: [88039]

Details for d1pdwc_

PDB Entry: 1pdw, 2.2 Å

PDB Description: Crystal structure of human DJ-1, P 1 21 1 space group

SCOP Domain Sequences for d1pdwc_:

Sequence; same for both SEQRES and ATOM records:

>d1pdwc_ c.23.16.2 (C:) DJ-1 {Human (Homo sapiens)}
askralvilakgaeemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasleda
kkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfgs
kvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaqv
kaplvlk

Timeline for d1pdwc_:

• d1pdwc_ is new in SCOP 1.65
  
• d1pdwc_ appears in SCOP 1.67
  
• d1pdwc_ appears in the current release, SCOPe 2.08